Recombinant Human C1QA protein(23-245 aa), C-His-tagged

• Cat.No.: C1QA-2528H
• Product Overview: Recombinant Human C1QA protein(P02745)(23-245 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-245 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 25 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Gene Information

• Gene Name: C1QA complement component 1, q subcomponent, A chain [ Homo sapiens ]
• Official Symbol: C1QA
• Synonyms: C1QA; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; complement C1q subcomponent subunit A; complement component C1q, A chain
• Gene ID: 712
• mRNA Refseq: NM_015991
• Protein Refseq: NP_057075
• MIM: 120550
• UniProt ID: P02745