Recombinant Human C1QA protein(23-245 aa), C-His-tagged

Cat.No. : C1QA-2528H
Product Overview : Recombinant Human C1QA protein(P02745)(23-245 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-245 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 25 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Gene Name C1QA complement component 1, q subcomponent, A chain [ Homo sapiens ]
Official Symbol C1QA
Synonyms C1QA; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; complement C1q subcomponent subunit A; complement component C1q, A chain;
Gene ID 712
mRNA Refseq NM_015991
Protein Refseq NP_057075
MIM 120550
UniProt ID P02745

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QA Products

Required fields are marked with *

My Review for All C1QA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon