Recombinant Mouse C3 protein, His-SUMO-tagged
| Cat.No. : | C3-4246M |
| Product Overview : | Recombinant Mouse C3 protein(P01027)(1321-1663aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1321-1663aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 55.3 kDa |
| AA Sequence : | SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | C3 complement component 3 [ Mus musculus ] |
| Official Symbol | C3 |
| Synonyms | C3; complement component 3; complement C3; complement factor 3; complement component 3d; acylation stimulating protein; ASP; Plp; HSE-MSF; AI255234; |
| Gene ID | 12266 |
| mRNA Refseq | NM_009778 |
| Protein Refseq | NP_033908 |
| ◆ Recombinant Proteins | ||
| C3-1841H | Recombinant Human C3 Protein, MYC/DDK-tagged | +Inquiry |
| C3-1859H | Active Recombinant Human C3 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| C3-5613H | Active Recombinant Human C3 protein, His-GST-tagged | +Inquiry |
| C3-4325S | Recombinant Swine C3 Protein | +Inquiry |
| C3-4324R | Recombinant Rabbit C3 Protein | +Inquiry |
| ◆ Native Proteins | ||
| C3-8391H | Native Human C3 | +Inquiry |
| C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
| C3-012H | Native Human Complement C3c | +Inquiry |
| C3-194H | Native Human Complement C3c | +Inquiry |
| C3-05M | Native Mouse C3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C3-078HKCL | Human C3 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3 Products
Required fields are marked with *
My Review for All C3 Products
Required fields are marked with *
