Recombinant Mouse C3 protein, His-SUMO-tagged
Cat.No. : | C3-4246M |
Product Overview : | Recombinant Mouse C3 protein(P01027)(1321-1663aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1321-1663aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.3 kDa |
AA Sequence : | SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C3 complement component 3 [ Mus musculus ] |
Official Symbol | C3 |
Synonyms | C3; complement component 3; complement C3; complement factor 3; complement component 3d; acylation stimulating protein; ASP; Plp; HSE-MSF; AI255234; |
Gene ID | 12266 |
mRNA Refseq | NM_009778 |
Protein Refseq | NP_033908 |
◆ Recombinant Proteins | ||
C3-338C | Recombinant Cattle C3 Protein, His-tagged | +Inquiry |
C3-6956C | Recombinant Chicken C3 | +Inquiry |
C3-365HFL | Recombinant Full Length Human C3 Protein, C-Flag-tagged | +Inquiry |
C3-4324R | Recombinant Rabbit C3 Protein | +Inquiry |
C3-114C | Active Recombinant Cynomolgus C3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C3-01R | Native Rabbit C3 Protein | +Inquiry |
C3-02M | Native Monkey C3 Protein | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3 Products
Required fields are marked with *
My Review for All C3 Products
Required fields are marked with *