"C3" Related Products

Recombinant Mouse C3 protein, His-tagged

Cat.No. : C3-7632M
Product Overview : Recombinant Mouse C3 (Ala965~Arg1303) protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminus.
Source : E. coli
Species : Mouse
Tag : His
Form : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Molecular Mass : 42 kDa
Protein length : Ala965-Arg1303
AA Sequence : ADLSDQVPDTDSETRIILQGSPVVQMAEDAVDGERLKHLIVTPAGCGEQNMIGMTPTVIAVHYLDQTEQWEKFGIEKRQEALELIKKGYTQQLAFKQPSSAYAAFNNRPPSTWLTAYVVKVFSLAANLIAIDSHVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNAKEADVSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALMNKLEEPYLGKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQTDVPDHKDLNWDVSFHLPSR
Endotoxin : <1.0EU per 1µg (determined by the LAL method).
Purity : > 90%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name : C3 complement component 3 [ Mus musculus ]
Official Symbol : C3
Synonyms : C3; complement component 3; complement C3; complement factor 3; complement component 3d; ASP; Plp; HSE-MSF; AI255234;
Gene ID : 12266
mRNA Refseq : NM_009778
Protein Refseq : NP_033908
UniProt ID : P01027

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.