Recombinant Mouse C3 protein, His-tagged

Cat.No. : C3-7632M
Product Overview : Recombinant Mouse C3 (Ala965~Arg1303) protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : Ala965-Arg1303
Form : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Molecular Mass : 42 kDa
AA Sequence : ADLSDQVPDTDSETRIILQGSPVVQMAEDAVDGERLKHLIVTPAGCGEQNMIGMTPTVIAVHYLDQTEQWEKFGIEKRQEALELIKKGYTQQLAFKQPSSAYAAFNNRPPSTWLTAYVVKVFSLAANLIAIDSHVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNAKEADVSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALMNKLEEPYLGKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQTDVPDHKDLNWDVSFHLPSR
Endotoxin : <1.0EU per 1µg (determined by the LAL method).
Purity : > 90%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name C3 complement component 3 [ Mus musculus ]
Official Symbol C3
Synonyms C3; complement component 3; complement C3; complement factor 3; complement component 3d; ASP; Plp; HSE-MSF; AI255234;
Gene ID 12266
mRNA Refseq NM_009778
Protein Refseq NP_033908
UniProt ID P01027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3 Products

Required fields are marked with *

My Review for All C3 Products

Required fields are marked with *

0
cart-icon
0
compare icon