Recombinant Mouse C3 protein, His-tagged
Cat.No. : | C3-7632M |
Product Overview : | Recombinant Mouse C3 (Ala965~Arg1303) protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala965-Arg1303 |
Form : | PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. |
Molecular Mass : | 42 kDa |
AA Sequence : | ADLSDQVPDTDSETRIILQGSPVVQMAEDAVDGERLKHLIVTPAGCGEQNMIGMTPTVIAVHYLDQTEQWEKFGIEKRQEALELIKKGYTQQLAFKQPSSAYAAFNNRPPSTWLTAYVVKVFSLAANLIAIDSHVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNAKEADVSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALMNKLEEPYLGKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQTDVPDHKDLNWDVSFHLPSR |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method). |
Purity : | > 90% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | C3 complement component 3 [ Mus musculus ] |
Official Symbol | C3 |
Synonyms | C3; complement component 3; complement C3; complement factor 3; complement component 3d; ASP; Plp; HSE-MSF; AI255234; |
Gene ID | 12266 |
mRNA Refseq | NM_009778 |
Protein Refseq | NP_033908 |
UniProt ID | P01027 |
◆ Recombinant Proteins | ||
C3-7844P | Recombinant Pig C3 protein, His & T7-tagged | +Inquiry |
C3-365HFL | Recombinant Full Length Human C3 Protein, C-Flag-tagged | +Inquiry |
C3-603H | Active Recombinant Human C3 | +Inquiry |
C3-338C | Recombinant Cattle C3 Protein, His-tagged | +Inquiry |
C3-10H | Active Recombinant Human C3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C3 Products
Required fields are marked with *
My Review for All C3 Products
Required fields are marked with *
0
Inquiry Basket