Recombinant Mouse CASP1 protein, GST-tagged
Cat.No. : | CASP1-5743M |
Product Overview : | Recombinant Mouse CASP1 protein(119-296 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 119-296 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFK |
Gene Name | Casp1 caspase 1 [ Mus musculus ] |
Official Symbol | CASP1 |
Synonyms | CASP1; caspase 1; caspase-1; p45; CASP-1; IL-1BC; IL-1B converting enzyme; IL-1 beta-converting enzyme; interleukin-1 beta convertase; interleukin 1 beta-converting enzyme; interleukin-1 beta-converting enzyme; ICE; Il1bc; |
Gene ID | 12362 |
mRNA Refseq | NM_009807 |
Protein Refseq | NP_033937 |
◆ Recombinant Proteins | ||
CASP1-2748M | Recombinant Mouse CASP1 Protein | +Inquiry |
CASP1-173H | Recombinant Human CASP1 Protein, His-tagged | +Inquiry |
CASP1-621H | Recombinant Human CASP1 Protein, His-tagged | +Inquiry |
CASP1-180H | Recombinant Human CASP1 protein, His-tagged | +Inquiry |
CASP1-432H | Recombinant Human CASP1 protein, HA-tagged | +Inquiry |
◆ Native Proteins | ||
CASP1-596H | Active Recombinant Human CASP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *