Recombinant Pig CASP1 protein, His&Myc-tagged
| Cat.No. : | CASP1-473P |
| Product Overview : | Recombinant Pig CASP1 protein(Q9N2I1)(120-297aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 120-297a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | NPVKPASSEPRGSLKLCPPDIAQRLWKEKSAEIYPIMGKSIRTRLALIICNTEFENLPRRDGADVDIRDMKILLEDLGYSVDVRENLTASDMAIELKAFAARPEHKSSDSTFLVLMSHGIQAGICGKKYSEEVPDVLEVNTVFQILNTLNCPSLKDKPKVIIIQACRGEKQGVVWIKD |
| Gene Name | CASP1 caspase 1, apoptosis-related cysteine peptidase [ Sus scrofa ] |
| Official Symbol | CASP1 |
| Synonyms | CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase-1; ICE; p45; CASP-1; IL-1BC; IL-1 beta-converting enzyme; interleukin-1 beta convertase; interleukin-1 beta converting enzyme; interleukin-1 beta-converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); |
| Gene ID | 397319 |
| mRNA Refseq | NM_214162 |
| Protein Refseq | NP_999327 |
| ◆ Cell & Tissue Lysates | ||
| CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
| CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *



