Recombinant Mouse CBLN3 Protein (25-197 aa), His-tagged

• Cat.No.: CBLN3-2735M
• Product Overview: Recombinant Mouse CBLN3 Protein (25-197 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 25-197 aa
• Description: May be involved in synaptic functions in the CNS.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.4 kDa
• AA Sequence: QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Cbln3 cerebellin 3 precursor protein [ Mus musculus ]
• Official Symbol: CBLN3
• Synonyms: CBLN3; cerebellin 3 precursor protein; cerebellin-3; precerebellin 3
• Gene ID: 56410
• mRNA Refseq: NM_019820
• Protein Refseq: NP_062794
• UniProt ID: Q9JHG0