Recombinant Mouse CBLN3 Protein (25-197 aa), His-tagged
Cat.No. : | CBLN3-2735M |
Product Overview : | Recombinant Mouse CBLN3 Protein (25-197 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-197 aa |
Description : | May be involved in synaptic functions in the CNS. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.4 kDa |
AA Sequence : | QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Cbln3 cerebellin 3 precursor protein [ Mus musculus ] |
Official Symbol | CBLN3 |
Synonyms | CBLN3; cerebellin 3 precursor protein; cerebellin-3; precerebellin 3; |
Gene ID | 56410 |
mRNA Refseq | NM_019820 |
Protein Refseq | NP_062794 |
UniProt ID | Q9JHG0 |
◆ Recombinant Proteins | ||
CBLN3-470R | Recombinant Rhesus Macaque CBLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cbln3-1977M | Recombinant Mouse Cbln3 Protein, Myc/DDK-tagged | +Inquiry |
Cbln3-2471M | Recombinant Mouse Cbln3 protein, His-SUMO-tagged | +Inquiry |
CBLN3-2726H | Recombinant Human CBLN3 Protein, MYC/DDK-tagged | +Inquiry |
CBLN3-1266M | Recombinant Mouse CBLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBLN3 Products
Required fields are marked with *
My Review for All CBLN3 Products
Required fields are marked with *