Recombinant Mouse CBLN3 Protein (25-197 aa), His-tagged

Cat.No. : CBLN3-2735M
Product Overview : Recombinant Mouse CBLN3 Protein (25-197 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 25-197 aa
Description : May be involved in synaptic functions in the CNS.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.4 kDa
AA Sequence : QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Cbln3 cerebellin 3 precursor protein [ Mus musculus ]
Official Symbol CBLN3
Synonyms CBLN3; cerebellin 3 precursor protein; cerebellin-3; precerebellin 3;
Gene ID 56410
mRNA Refseq NM_019820
Protein Refseq NP_062794
UniProt ID Q9JHG0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBLN3 Products

Required fields are marked with *

My Review for All CBLN3 Products

Required fields are marked with *

0
cart-icon