Recombinant Mouse Ccl21c protein(24-133aa)
Cat.No. : | Ccl21c-532M |
Product Overview : | Recombinant Mouse Ccl21c protein(P86793)(24-133aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 24-133aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Gene Name | Ccl21c chemokine (C-C motif) ligand 21C (leucine) [ Mus musculus ] |
Official Symbol | Ccl21c |
Synonyms | CCL21C; chemokine (C-C motif) ligand 21C (leucine); C-C motif chemokine 21c; 6Ckine; Ccl21-leu; C-C motif chemokine 21b; beta chemokine exodus-2; beta-chemokine exodus-2; Small-inducible cytokine A21b; small inducible cytokine A21c; small-inducible cytokine A21c; thymus-derived chemotactic agent 4; SLC; CKb9; TCA4; Ccl21b; Scya21; Scya21b; Scya21c; exodus-2; |
Gene ID | 65956 |
mRNA Refseq | NM_023052 |
Protein Refseq | NP_075539 |
◆ Recombinant Proteins | ||
Ccl21c-532M | Recombinant Mouse Ccl21c protein(24-133aa) | +Inquiry |
Ccl21c-2119M | Recombinant Mouse Ccl21c protein(24-133aa), His-SUMO-tagged | +Inquiry |
Ccl21c-7138M | Recombinant Mouse Ccl21c protein, His & GST-tagged | +Inquiry |
Ccl21c-120M | Recombinant Mouse Chemokine (C-C motif) Ligand 21C (Leucine) | +Inquiry |
CCL21C-2967M | Recombinant Mouse CCL21C Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl21c Products
Required fields are marked with *
My Review for All Ccl21c Products
Required fields are marked with *