Recombinant Mouse Ccl21c protein(24-133aa), His-SUMO-tagged

Cat.No. : Ccl21c-2119M
Product Overview : Recombinant Mouse Ccl21c protein(P86793)(24-133aa), fused with N-terminal His and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 24-133aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.0 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Gene Name Ccl21c chemokine (C-C motif) ligand 21C (leucine) [ Mus musculus ]
Official Symbol Ccl21c
Synonyms CCL21C; chemokine (C-C motif) ligand 21C (leucine); C-C motif chemokine 21c; 6Ckine; Ccl21-leu; C-C motif chemokine 21b; beta chemokine exodus-2; beta-chemokine exodus-2; Small-inducible cytokine A21b; small inducible cytokine A21c; small-inducible cytokine A21c; thymus-derived chemotactic agent 4; SLC; CKb9; TCA4; Ccl21b; Scya21; Scya21b; Scya21c; exodus-2;
Gene ID 65956
mRNA Refseq NM_023052
Protein Refseq NP_075539

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl21c Products

Required fields are marked with *

My Review for All Ccl21c Products

Required fields are marked with *

0
cart-icon