Recombinant Mouse Ccl25 protein, His-tagged
Cat.No. : | Ccl25-2655M |
Product Overview : | Recombinant Mouse Ccl25 protein(O35903)(25-144aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-144aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18 kDa |
AA Sequence : | GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ccl25 chemokine (C-C motif) ligand 25 [ Mus musculus ] |
Official Symbol | Ccl25 |
Synonyms | CCL25; chemokine (C-C motif) ligand 25; C-C motif chemokine 25; thymus-expressed chemokine; small inducible chemokine 25; small inducible cytokine A25; TECK; CKb15; Scya25; AI852536; A130072A22Rik; |
Gene ID | 20300 |
mRNA Refseq | NM_009138 |
Protein Refseq | NP_033164 |
◆ Recombinant Proteins | ||
CCL25-10846H | Recombinant Human CCL25, His-tagged | +Inquiry |
CCL25-2654H | Recombinant Human CCL25 protein, GST-tagged | +Inquiry |
CCL25-1015H | Recombinant Human CCL25 Protein (Gln24-Leu150), N-His tagged | +Inquiry |
CCL25-054C | Active Recombinant Human CCL25 Protein (127 aa) | +Inquiry |
CCL25-202H | Active Recombinant Human CCL25 protein, Fc-tagged, non-lytic | +Inquiry |
◆ Native Proteins | ||
CCL25-31214TH | Native Human CCL25 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL25-7726HCL | Recombinant Human CCL25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl25 Products
Required fields are marked with *
My Review for All Ccl25 Products
Required fields are marked with *