Recombinant Mouse Ccl7 protein
Cat.No. : | Ccl7-618M |
Product Overview : | Recombinant Mouse Ccl7 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 74 |
Description : | Murine CCL7, also known as MARC, is belonging to the CC chemokine family. It is encoded by the gene CCL7 and was isolated from a mouse mast cell line after Fc epsilon RI triggering by IgE plus antigen. Sequence comparisons suggest that MARC may be the mouse homologue of the human MCP-3 gene. Similar to the human system, MARC/FIC is postulated the murine MCP-3. The MCP-3 protein family signals through CCR2 expect MCP-1 and possess cross-reacts across species. CCL7/MCP3 has chemotactic function for monocytes and eosinophils, but not for neutrophils. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2× PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human monocytes is in a concentration range of 100-300 ng/ml. |
Molecular Mass : | Approximately 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
Endotoxin : | Less than 1 EU/µg of rMuMCP-3/CCL7 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl7 |
Official Symbol | Ccl7 |
Synonyms | CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; small inducible cytokine A7; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3; fic; marc; mcp3; MCP-3; Scya7; |
Gene ID | 20306 |
mRNA Refseq | NM_013654 |
Protein Refseq | NP_038682 |
UniProt ID | Q03366 |
◆ Recombinant Proteins | ||
CCL7-628H | Recombinant Human CCL7 protein (Gln 24-Leu 99), His-tagged | +Inquiry |
CCL7-025H | Recombinant Human CCL7 Protein | +Inquiry |
Ccl7-287M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 7 | +Inquiry |
CCL7-286H | Recombinant Human CCL7 protein | +Inquiry |
CCL7-194H | Recombinant Human CCL7 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL7-170HCL | Recombinant Human CCL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl7 Products
Required fields are marked with *
My Review for All Ccl7 Products
Required fields are marked with *
0
Inquiry Basket