Recombinant Mouse chemokine (C-C motif) receptor 2 Protein, His-tagged
Cat.No. : | CCR2-3014M |
Product Overview : | Recombinant Mouse CCR2 Protein with N-10×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including leukocyte migration; positive regulation of cell migration; and regulation of cytokine production. Acts upstream of or within several processes, including cellular defense response; monocyte chemotaxis; and neutrophil clearance. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Used to study Coronavirus infectious disease and age related macular degeneration. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; aggressive periodontitis; coronary artery disease (multiple); glucose metabolism disease (multiple); and uveitis (multiple). Orthologous to human CCR2 (C-C motif chemokine receptor 2). |
Tag : | N-10×His |
Molecular Mass : | 48.8 kDa |
AA Sequence : | MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.4 mg/mL |
Storage Buffer : | 20 mM Tris-HCl, 0.15 M NaCl, 0.05 % FOS12, pH 8.0, 20 % glycerol |
Gene Name | Ccr2 chemokine (C-C motif) receptor 2 [ Mus musculus (house mouse) ] |
Official Symbol | Ccr2 |
Synonyms | CCR2; chemokine (C-C motif) receptor 2; C-C chemokine receptor type 2; CCR-2; C-C CKR-2; MIP-1 alphaR; MCP-1 receptor; JE/FIC receptor; chemokine (C-C) receptor 2; chemoattractant protein-1 receptor; C-C CHEMOKINE RECEPTOR TYPE 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC RECEPTOR) (MCP-1 RECEPTOR); Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2 |
Gene ID | 12772 |
mRNA Refseq | NM_009915 |
Protein Refseq | NP_034045 |
UniProt ID | P51683 |
◆ Recombinant Proteins | ||
CCR2-3014M | Recombinant Mouse chemokine (C-C motif) receptor 2 Protein, His-tagged | +Inquiry |
CCR2-3954H | Active Recombinant Human CCR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CCR2-705R | Recombinant Rhesus Monkey CCR2 Protein, His-tagged | +Inquiry |
CCR2-0689H | Recombinant Human CCR2 Protein, GST-Tagged | +Inquiry |
CCR2-15H | Active Recombinant Human CCR2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccr2 Products
Required fields are marked with *
My Review for All Ccr2 Products
Required fields are marked with *
0
Inquiry Basket