Recombinant Mouse Cd200 protein(31-232aa), His&Myc-tagged
Cat.No. : | Cd200-392M |
Product Overview : | Recombinant Mouse Cd200 protein(O54901)(31-232aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 31-232aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG |
Gene Name | Cd200 CD200 antigen [ Mus musculus ] |
Official Symbol | Cd200 |
Synonyms | CD200; CD200 antigen; OX-2 membrane glycoprotein; MRC OX-2 antigen; antigen identified by monoclonal MRC OX-2; OX2; Mox2; |
Gene ID | 17470 |
mRNA Refseq | NM_010818 |
Protein Refseq | NP_034948 |
◆ Recombinant Proteins | ||
CD200-133H | Recombinant Human CD200 Protein, His-tagged | +Inquiry |
CD200-2486C | Recombinant Chicken CD200 | +Inquiry |
CD200-134H | Recombinant Human CD200 Protein, Fc-tagged | +Inquiry |
CD200-629H | Recombinant Human CD200, Fc-His tagged | +Inquiry |
CD200-151H | Active Recombinant Human CD200 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD200-1041CCL | Recombinant Cynomolgus CD200 cell lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *