Recombinant Mouse Cd63 protein, His-tagged
Cat.No. : | Cd63-2669M |
Product Overview : | Recombinant Mouse Cd63 protein(P41731)(103-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 103-203aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.5 |
AA Sequence : | AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cd63 CD63 antigen [ Mus musculus ] |
Official Symbol | Cd63 |
Synonyms | CD63; CD63 antigen; melanoma 1 antigen; ME491; C75951; Tspan30; MGC103180; MGC107286; |
Gene ID | 12512 |
mRNA Refseq | NM_001042580 |
Protein Refseq | NP_001036045 |
◆ Recombinant Proteins | ||
CD63-101C | Recombinant Cynomolgus CD63 protein, His-tagged | +Inquiry |
Cd63-30R | Recombinant Rat Cd63, His tagged | +Inquiry |
CD63-3890H | Recombinant Human CD63 protein, His-tagged | +Inquiry |
CD63-396M | Recombinant Mouse CD63 Protein (103-203 aa), GST-tagged | +Inquiry |
CD63-1286H | Recombinant Human CD63 Protein (Ala103-Val203), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd63 Products
Required fields are marked with *
My Review for All Cd63 Products
Required fields are marked with *
0
Inquiry Basket