Recombinant Mouse CD74, His-tagged

Cat.No. : CD74-9493M
Product Overview : A DNA sequence encoding the extracellular domain (56-215) of mouse CD74 isoform 2 was fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 56-215 a.a.
Form : 25 mM Tris-HCl, pH7.4, 100 mM NaCl, 1 mM DTT
Molecular Mass : The recombinant mouse CD74 consists of 160 amino acids and has a calculated molecular mass of 18.3KDa. It migrates as an approximately 25kDa band in SDS-PAGE under reducing conditions due to glycosylation.
AA Sequence : QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLT RSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGV TRQELGQVTL
Purity : >95% as determined by SDS-PAGE
Storage : Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃. Recommend to aliquot the proteinin to smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name Cd74 CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) [ Mus musculus ]
Official Symbol CD74
Synonyms CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); H-2 class II histocompatibility antigen gamma chain; HLA-DR-GAMMA; dinucleotide microsatellite; Ia-associated invariant chain; ia antigen-associated invariant chain; MHC class II-associated invariant chain; class II-associated invariant chain peptide; histocompatibility: class II antigens, gamma chain of; invariant polypeptide of major histocompatibility complex, class II antigen-associated; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA;
Gene ID 16149
mRNA Refseq NM_001042605
Protein Refseq NP_001036070
Pathway Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem;
Function MHC class II protein binding; beta-amyloid binding; contributes_to cytokine binding; cytokine binding; cytokine receptor activity; cytokine receptor activity; nitric-oxide synthase binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD74 Products

Required fields are marked with *

My Review for All CD74 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon