Recombinant Mouse CD74, His-tagged
Cat.No. : | CD74-9493M |
Product Overview : | A DNA sequence encoding the extracellular domain (56-215) of mouse CD74 isoform 2 was fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 56-215 a.a. |
Form : | 25 mM Tris-HCl, pH7.4, 100 mM NaCl, 1 mM DTT |
Molecular Mass : | The recombinant mouse CD74 consists of 160 amino acids and has a calculated molecular mass of 18.3KDa. It migrates as an approximately 25kDa band in SDS-PAGE under reducing conditions due to glycosylation. |
AA Sequence : | QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLT RSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGV TRQELGQVTL |
Purity : | >95% as determined by SDS-PAGE |
Storage : | Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃. Recommend to aliquot the proteinin to smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles. |
Gene Name | Cd74 CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) [ Mus musculus ] |
Official Symbol | CD74 |
Synonyms | CD74; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); H-2 class II histocompatibility antigen gamma chain; HLA-DR-GAMMA; dinucleotide microsatellite; Ia-associated invariant chain; ia antigen-associated invariant chain; MHC class II-associated invariant chain; class II-associated invariant chain peptide; histocompatibility: class II antigens, gamma chain of; invariant polypeptide of major histocompatibility complex, class II antigen-associated; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA; |
Gene ID | 16149 |
mRNA Refseq | NM_001042605 |
Protein Refseq | NP_001036070 |
Pathway | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Tuberculosis, organism-specific biosystem; Tuberculosis, conserved biosystem; |
Function | MHC class II protein binding; beta-amyloid binding; contributes_to cytokine binding; cytokine binding; cytokine receptor activity; cytokine receptor activity; nitric-oxide synthase binding; protein binding; |
◆ Recombinant Proteins | ||
CD74-2232H | Active Recombinant Human CD74, HA-tagged | +Inquiry |
CD74-2228H | Recombinant Human CD74, Myc-DDK-Tagged | +Inquiry |
RFL12540RF | Recombinant Full Length Rat H-2 Class Ii Histocompatibility Antigen Gamma Chain(Cd74) Protein, His-Tagged | +Inquiry |
CD74-2230H | Recombinant Human CD74, GST-Tagged | +Inquiry |
CD74-546H | Active Recombinant Human CD74 Protein, HA-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD74 Products
Required fields are marked with *
My Review for All CD74 Products
Required fields are marked with *
0
Inquiry Basket