Recombinant Mouse Cd82 protein, His-SUMO-tagged
Cat.No. : | Cd82-2674M |
Product Overview : | Recombinant Mouse Cd82 protein(P40237)(111-227aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 111-227aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cd82 CD82 antigen [ Mus musculus ] |
Official Symbol | Cd82 |
Synonyms | CD82; CD82 antigen; IA4; C33 antigen; inducible membrane protein R2; metastasis suppressor Kangai-1 homolog; kangai 1 (suppression of tumorigenicity 6, prostate); C33; Kai1; Tspan27; AA682076; AL023070; |
Gene ID | 12521 |
mRNA Refseq | NM_001136055 |
Protein Refseq | NP_001129527 |
◆ Recombinant Proteins | ||
CD82-3721H | Recombinant Human CD82 Protein (Gly111-Leu228), C-His tagged | +Inquiry |
CD82-3070HF | Recombinant Full Length Human CD82 Protein, GST-tagged | +Inquiry |
CD82-127H | Recombinant Human CD82 protein, His-tagged | +Inquiry |
CD82-27889TH | Recombinant Human CD82 | +Inquiry |
RFL2400MF | Recombinant Full Length Mouse Cd82 Antigen(Cd82) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD82-1960HCL | Recombinant Human CD82 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd82 Products
Required fields are marked with *
My Review for All Cd82 Products
Required fields are marked with *