Recombinant Mouse Cela2a protein, His-tagged
| Cat.No. : | Cela2a-2686M |
| Product Overview : | Recombinant Mouse Cela2a protein(P05208)(31-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-271aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.7 kDa |
| AA Sequence : | VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| Cela2a-1161M | Recombinant Mouse Cela2a protein, His & T7-tagged | +Inquiry |
| CELA2A-402H | Recombinant Human CELA2A Protein (29-269 aa), His-tagged | +Inquiry |
| CELA2A-1329R | Recombinant Rat CELA2A Protein | +Inquiry |
| CELA2A-1357H | Recombinant Human CELA2A Protein (29-269 aa), His-tagged | +Inquiry |
| Cela2a-1273R | Recombinant Rat Cela2a Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CELA2A-7594HCL | Recombinant Human CELA2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cela2a Products
Required fields are marked with *
My Review for All Cela2a Products
Required fields are marked with *
