Recombinant Mouse Cela2a protein, His-tagged
Cat.No. : | Cela2a-2686M |
Product Overview : | Recombinant Mouse Cela2a protein(P05208)(31-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-271aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
CELA2A-1357H | Recombinant Human CELA2A Protein (29-269 aa), His-tagged | +Inquiry |
CELA2A-3257C | Recombinant Chicken CELA2A | +Inquiry |
Cela2a-1161M | Recombinant Mouse Cela2a protein, His & T7-tagged | +Inquiry |
CELA2A-402H | Recombinant Human CELA2A Protein (29-269 aa), His-tagged | +Inquiry |
CELA2A-1329R | Recombinant Rat CELA2A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA2A-7594HCL | Recombinant Human CELA2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cela2a Products
Required fields are marked with *
My Review for All Cela2a Products
Required fields are marked with *