Recombinant Mouse Chrna1 protein, His-tagged
Cat.No. : | Chrna1-2696M |
Product Overview : | Recombinant Mouse Chrna1 protein(P04756)(21-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-230aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.5 kDa |
AA Sequence : | SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Chrna1 cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) [ Mus musculus ] |
Official Symbol | Chrna1 |
Synonyms | CHRNA1; cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle); acetylcholine receptor subunit alpha; acetylcholine receptor alpha; Acra; Achr-1; AI385656; AI608266; |
Gene ID | 11435 |
mRNA Refseq | NM_007389 |
Protein Refseq | NP_031415 |
◆ Recombinant Proteins | ||
CHRNA1-407T | Recombinant Torpedo Californica CHRNA1 Protein (25-234 aa), His-SUMO-tagged | +Inquiry |
CHRNA1-5379H | Recombinant Human CHRNA1 protein, His-PDI-tagged | +Inquiry |
CHRNA1-3225HF | Recombinant Full Length Human CHRNA1 Protein, GST-tagged | +Inquiry |
CHRNA1-1277H | Recombinant Human CHRNA1 Protein, GST-Tagged | +Inquiry |
CHRNA1-1472P | Recombinant Pacific electric ray CHRNA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Chrna1 Products
Required fields are marked with *
My Review for All Chrna1 Products
Required fields are marked with *
0
Inquiry Basket