Recombinant Mouse CLEC4A Protein (70-238 aa), His-SUMO-Myc-tagged
| Cat.No. : | CLEC4A-2212M |
| Product Overview : | Recombinant Mouse CLEC4A Protein (70-238 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 70-238 aa |
| Description : | May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Clec4a2 C-type lectin domain family 4, member a2 [ Mus musculus (house mouse) ] |
| Official Symbol | CLEC4A |
| Synonyms | Clec4a; DCIR; Dcir1; Clec4a; Clecsf6; |
| Gene ID | 26888 |
| mRNA Refseq | NM_001170332 |
| Protein Refseq | NP_001163803 |
| UniProt ID | Q9QZ15 |
| ◆ Recombinant Proteins | ||
| CLEC4A-1467H | Recombinant Human CLEC4A Protein, GST-tagged | +Inquiry |
| CLEC4A-1066H | Recombinant Human CLEC4A protein(Gln70-Leu237), hFc-tagged | +Inquiry |
| CLEC4A-2158HF | Recombinant Full Length Human CLEC4A Protein, GST-tagged | +Inquiry |
| CLEC4A-3789H | Recombinant Human CLEC4A protein, rFc-tagged | +Inquiry |
| CLEC4A-110H | Recombinant Human CLEC4A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC4A-2282HCL | Recombinant Human CLEC4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4A Products
Required fields are marked with *
My Review for All CLEC4A Products
Required fields are marked with *



