Recombinant Mouse CLEC4A Protein (70-238 aa), His-SUMO-Myc-tagged
Cat.No. : | CLEC4A-2212M |
Product Overview : | Recombinant Mouse CLEC4A Protein (70-238 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 70-238 aa |
Description : | May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.6 kDa |
AA Sequence : | QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Clec4a2 C-type lectin domain family 4, member a2 [ Mus musculus (house mouse) ] |
Official Symbol | CLEC4A |
Synonyms | Clec4a; DCIR; Dcir1; Clec4a; Clecsf6; |
Gene ID | 26888 |
mRNA Refseq | NM_001170332 |
Protein Refseq | NP_001163803 |
UniProt ID | Q9QZ15 |
◆ Recombinant Proteins | ||
CLEC4A-2212M | Recombinant Mouse CLEC4A Protein (70-238 aa), His-SUMO-Myc-tagged | +Inquiry |
CLEC4A-3353H | Recombinant Human CLEC4A protein(Gln70-Leu237), His-tagged | +Inquiry |
CLEC4A-1342M | Recombinant Mouse CLEC4A protein(Gln70-Leu238), His-tagged | +Inquiry |
CLEC4A-1791R | Recombinant Rhesus Monkey CLEC4A Protein | +Inquiry |
CLEC4A-110H | Recombinant Human CLEC4A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4A-2282HCL | Recombinant Human CLEC4A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4A Products
Required fields are marked with *
My Review for All CLEC4A Products
Required fields are marked with *
0
Inquiry Basket