Recombinant Mouse Col4a3 protein, His&Myc-tagged
Cat.No. : | Col4a3-646M |
Product Overview : | Recombinant Mouse Col4a3 protein(Q9QZS0)(1424-1669aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1424-1669aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH |
Gene Name | Col4a3 collagen, type IV, alpha 3 [ Mus musculus ] |
Official Symbol | Col4a3 |
Synonyms | COL4A3; collagen, type IV, alpha 3; collagen alpha-3(IV) chain; tumstatin; collagen type IV alpha3 chain; procollagen, type IV, alpha 3; [a]3(IV); alpha3(IV); |
Gene ID | 12828 |
mRNA Refseq | NM_007734 |
Protein Refseq | NP_031760 |
◆ Recombinant Proteins | ||
Col4a3-646M | Recombinant Mouse Col4a3 protein, His&Myc-tagged | +Inquiry |
COL4A3-334H | Recombinant Human COL4A3 Protein, His/GST-tagged | +Inquiry |
COL4A3-2715H | Recombinant Human COL4A3 protein, His-tagged | +Inquiry |
COL4A3-3737M | Recombinant Mouse COL4A3 Protein | +Inquiry |
COL4A3-1132B | Recombinant Bovine COL4A3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL4A3-1219RCL | Recombinant Rat COL4A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Col4a3 Products
Required fields are marked with *
My Review for All Col4a3 Products
Required fields are marked with *