Recombinant Mouse Cox5a protein, His-SUMO&Myc-tagged
Cat.No. : | Cox5a-6544M |
Product Overview : | Recombinant Mouse Cox5a protein(P12787)(38-146aa), fused with N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 38-146aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV |
Gene Name | Cox5a cytochrome c oxidase, subunit Va [ Mus musculus ] |
Official Symbol | Cox5a |
Synonyms | COX5A; cytochrome c oxidase, subunit Va; cytochrome c oxidase subunit 5A, mitochondrial; cytochrome c oxidase polypeptide Va; CcOX; AA959768; |
Gene ID | 12858 |
mRNA Refseq | NM_007747 |
Protein Refseq | NP_031773 |
◆ Recombinant Proteins | ||
COX5A-2007HF | Recombinant Full Length Human COX5A Protein, GST-tagged | +Inquiry |
COX5A-1750H | Recombinant Human COX5A Protein, GST-tagged | +Inquiry |
COX5A-7085H | Recombinant Human COX5A, His-tagged | +Inquiry |
COX5A-815R | Recombinant Rhesus Macaque COX5A Protein, His (Fc)-Avi-tagged | +Inquiry |
COX5A-3815M | Recombinant Mouse COX5A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX5A-389HCL | Recombinant Human COX5A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cox5a Products
Required fields are marked with *
My Review for All Cox5a Products
Required fields are marked with *