Recombinant Mouse Csf1r Protein, GST-tagged

Cat.No. : Csf1r-1966M
Product Overview : Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Wheat Germ
Tag : GST
Description : Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
Molecular Mass : 37.62 kDa
AA Sequence : ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name Csf1r colony stimulating factor 1 receptor [ Mus musculus ]
Official Symbol Csf1r
Synonyms CSF1R; colony stimulating factor 1 receptor; macrophage colony-stimulating factor 1 receptor; c-fms; CSF-1-R; CSF-1 receptor; proto-oncogene fms; proto-oncogene c-Fms; Fms; CD115; Csfmr; Fim-2; CSF-1R; M-CSFR; M-CSF-R; AI323359;
Gene ID 12978
mRNA Refseq NM_001037859
Protein Refseq NP_001032948

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf1r Products

Required fields are marked with *

My Review for All Csf1r Products

Required fields are marked with *

0

Inquiry Basket

cartIcon