Recombinant Mouse Csf1r Protein, GST-tagged
| Cat.No. : | Csf1r-1966M |
| Product Overview : | Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34. |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | Csf1r colony stimulating factor 1 receptor [ Mus musculus ] |
| Official Symbol | Csf1r |
| Synonyms | CSF1R; colony stimulating factor 1 receptor; macrophage colony-stimulating factor 1 receptor; c-fms; CSF-1-R; CSF-1 receptor; proto-oncogene fms; proto-oncogene c-Fms; Fms; CD115; Csfmr; Fim-2; CSF-1R; M-CSFR; M-CSF-R; AI323359; |
| Gene ID | 12978 |
| mRNA Refseq | NM_001037859 |
| Protein Refseq | NP_001032948 |
| ◆ Recombinant Proteins | ||
| CSF1R-051H | Active Recombinant Human CSF1R protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
| CSF1R-935H | Recombinant Human CSF1R Protein, DDK/His-tagged | +Inquiry |
| CSF1R-1319H | Recombinant Human CSF1R Protein (Y538-C972), Tag Free | +Inquiry |
| CSF1R-936H | Recombinant Human CSF1R Protein, DDK-tagged | +Inquiry |
| CSF1R-3774H | Recombinant Human CSF1R protein, rFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSF1R-2739HCL | Recombinant Human CSF1R cell lysate | +Inquiry |
| CSF1R-444HCL | Recombinant Human CSF1R cell lysate | +Inquiry |
| CSF1R-2091MCL | Recombinant Mouse CSF1R cell lysate | +Inquiry |
| CSF1R-823RCL | Recombinant Rat CSF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf1r Products
Required fields are marked with *
My Review for All Csf1r Products
Required fields are marked with *
