Recombinant Mouse Cst3 protein, His&Myc-tagged
Cat.No. : | Cst3-2748M |
Product Overview : | Recombinant Mouse Cst3 protein(P21460)(21-140aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-140aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cst3 cystatin C [ Mus musculus ] |
Official Symbol | Cst3 |
Synonyms | CST3; cystatin C; cystatin-C; cystatin 3; cystatin-3; CysC; |
Gene ID | 13010 |
mRNA Refseq | NM_009976 |
Protein Refseq | NP_034106 |
◆ Recombinant Proteins | ||
CST3-50H | Recombinant Human CST3 protein, His-tagged | +Inquiry |
CST3-2641H | Active Recombinant Human CST3 protein, His-tagged | +Inquiry |
CST3-893R | Recombinant Rhesus Macaque CST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cst3-246M | Recombinant Mouse Cystatin C, His-tagged | +Inquiry |
CST3-373M | Recombinant Mouse CST3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CST3-26152TH | Native Human CST3 | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST3-1938RCL | Recombinant Rat CST3 cell lysate | +Inquiry |
CST3-2991HCL | Recombinant Human CST3 cell lysate | +Inquiry |
CST3-2470MCL | Recombinant Mouse CST3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cst3 Products
Required fields are marked with *
My Review for All Cst3 Products
Required fields are marked with *