Recombinant Mouse Ctsb Protein, His-tagged
Cat.No. : | Ctsb-7184M |
Product Overview : | Recombinant Mouse Ctsb Protein with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Tag : | His |
Protein Length : | 18-339 |
Description : | This gene encodes a member of the peptidase C1 family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin B light and heavy chains, which can dimerize to generate the double chain form of the enzyme. This enzyme is a lysosomal cysteine protease with both endopeptidase and exopeptidase activity that may play a role in protein turnover. Homozygous knockout mice for this gene exhibit reduced pancreatic damage following induced pancreatitis and reduced hepatocyte apoptosis in a model of liver injury. Pseudogenes of this gene have been identified in the genome. |
Form : | Liquid |
Molecular Mass : | 36.4 kDa |
AA Sequence : | HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Ctsb cathepsin B [ Mus musculus (house mouse) ] |
Official Symbol | Ctsb |
Synonyms | Ctsb; cathepsin B; CB; cathepsin B; cathepsin B1; EC 3.4.22.1 |
Gene ID | 13030 |
mRNA Refseq | NM_007798 |
Protein Refseq | NP_031824 |
UniProt ID | P10605 |
◆ Recombinant Proteins | ||
CTSB-416R | Recombinant Rhesus CTSB protein, His-tagged | +Inquiry |
CTSB-385H | Recombinant Human CTSB protein, His-tagged | +Inquiry |
CTSB-911R | Recombinant Rhesus Macaque CTSB Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSB-5644H | Recombinant Human CTSB protein, His-tagged | +Inquiry |
CTSB-1062B | Recombinant Branchiostoma belcheri tsingtauense CTSB Protein (Ala15-Asp332), C-His tagged | +Inquiry |
◆ Native Proteins | ||
CTSB-5328H | Native Human Cathepsin B | +Inquiry |
CTSB-26408TH | Native Human CTSB | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
CTSB-3025HCL | Recombinant Human CTSB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsb Products
Required fields are marked with *
My Review for All Ctsb Products
Required fields are marked with *
0
Inquiry Basket