Recombinant Mouse Ctsw protein, His&Myc-tagged
| Cat.No. : | Ctsw-2768M |
| Product Overview : | Recombinant Mouse Ctsw protein(P56203)(126-371aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 126-371aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.2 kDa |
| AA Sequence : | VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ctsw cathepsin W [ Mus musculus ] |
| Official Symbol | Ctsw |
| Synonyms | CTSW; cathepsin W; lymphopain; |
| Gene ID | 13041 |
| mRNA Refseq | NM_009985 |
| Protein Refseq | NP_034115 |
| ◆ Recombinant Proteins | ||
| CTSW-4273H | Recombinant Human CTSW protein, His&Myc-tagged | +Inquiry |
| CTSW-2073M | Recombinant Mouse CTSW Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ctsw-8184M | Recombinant Mouse Ctsw protein, His & T7-tagged | +Inquiry |
| CTSW-1894H | Recombinant Human CTSW Protein (Ile22-Pro376), N-His tagged | +Inquiry |
| CTSW-404H | Recombinant Human cathepsin W, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsw Products
Required fields are marked with *
My Review for All Ctsw Products
Required fields are marked with *
