Recombinant Mouse Ctsw protein, His&Myc-tagged
Cat.No. : | Ctsw-2768M |
Product Overview : | Recombinant Mouse Ctsw protein(P56203)(126-371aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 126-371aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.2 kDa |
AA Sequence : | VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ctsw cathepsin W [ Mus musculus ] |
Official Symbol | Ctsw |
Synonyms | CTSW; cathepsin W; lymphopain; |
Gene ID | 13041 |
mRNA Refseq | NM_009985 |
Protein Refseq | NP_034115 |
◆ Recombinant Proteins | ||
CTSW-1894H | Recombinant Human CTSW Protein (Ile22-Pro376), N-His tagged | +Inquiry |
Ctsw-1294R | Recombinant Rat Ctsw Protein, His&GST-tagged | +Inquiry |
CTSW-2364HF | Recombinant Full Length Human CTSW Protein, GST-tagged | +Inquiry |
CTSW-2119H | Recombinant Human CTSW Protein, GST-tagged | +Inquiry |
Ctsw-8184M | Recombinant Mouse Ctsw protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ctsw Products
Required fields are marked with *
My Review for All Ctsw Products
Required fields are marked with *
0
Inquiry Basket