Recombinant Mouse Cxcl10 protein

Cat.No. : Cxcl10-613M
Product Overview : Recombinant Mouse Cxcl10 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 77
Description : CXCL10 also known as IP-10 is belonging to the CXC chemokine family. It is encoded by the CXCL10 gene, and in murine it is also named the CRG-2 gene. The gene was originally identified as an immediate early gene induced in response to macrophage activation. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL10 has been shown to be a chemoattractant for activated T-lymphocytes and monocytes/macrophages. It also has other roles, such aspromotion of T cell adhesion to endothelial cells, and inhibition of bone marrow colony formation and angiogenesis. Murine CXCL10 shares approximately 67 % amino acid sequence identity with human CXCL10.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human peripheral blood lymphocytes is in a concentration range of 0.1-10.0 ng/ml in the presence of IL-2.
Molecular Mass : Approximately 8.7 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
AA Sequence : IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Endotoxin : Less than 1 EU/µg of rMuIP-10/CXCL10 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl10
Official Symbol Cxcl10
Synonyms CXCL10; chemokine (C-X-C motif) ligand 10; C-X-C motif chemokine 10; gamma-IP10; interferon activated gene 10; small-inducible cytokine B10; interferon-gamma induced protein CRG-2; interferon-gamma-induced protein CRG-2; 10 kDa interferon gamma-induced protein; small inducible cytokine B subfamily (Cys-X-Cys), member 10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10;
Gene ID 15945
mRNA Refseq NM_021274
Protein Refseq NP_067249
UniProt ID P17515

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl10 Products

Required fields are marked with *

My Review for All Cxcl10 Products

Required fields are marked with *

0
cart-icon
0
compare icon