Recombinant Mouse Cxcl16 protein

Cat.No. : Cxcl16-85M
Product Overview : Recombinant Mouse Cxcl16 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 88
Description : CXCL16 is a member of the CXC chemokine family. Larger than other chemokines, it is one of the only two transmembrane chemokines in the family and the other is CX3CL1. Mouse CXCL16 has 246 a.a. and consists of a 26 a.a. residue putative signal peptide, an 88 a.a. residue chemokine domain, an 87 a.a. residue mucin-like spacer region, a 22 a.a. residue transmembrane domain, and a 23 a.a. residue cytoplasmic tail. Mouse CXCL16 shares 70 % sequence identity with human CXCL16 in chemokine domain. CXCL16 interacts with the chemokine receptor CXCR6, also known as Bonzo. Expression of CXCL16 is induced by the inflammatory cytokines IFN-gamma and TNF-alpha. Functions of CXCL16 include inducing a strong chemotactic response and calcium mobilization. CXCL16 also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 20-1000 ng/ml.
Molecular Mass : Approximately 9.9 kDa, a single non-glycosylated polypeptide chain containing 88 amino acids.
AA Sequence : NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP
Endotoxin : Less than 1 EU/μg of rMuCXCL16 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl16
Official Symbol Cxcl16
Synonyms CXCL16; chemokine (C-X-C motif) ligand 16; C-X-C motif chemokine 16; SR-PSOX/CXCL16; Cxc chemokine ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16; zinc finger, MYND-type containing 15; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX; Zmynd15; AV290116; BB024863; CXCL16v1; CXCL16v2; 0910001K24Rik;
Gene ID 66102
mRNA Refseq NM_023158
Protein Refseq NP_075647
UniProt ID Q8BSU2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl16 Products

Required fields are marked with *

My Review for All Cxcl16 Products

Required fields are marked with *

0
cart-icon