Recombinant Mouse Cxcl3 Protein, His-tagged

Cat.No. : Cxcl3-7390M
Product Overview : Recombinant mouse CXCL3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 28-100
Description : This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils.
Form : Liquid
Molecular Mass : 10.6 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 50 % glycerol 0.15 M NaCl,5 mM DTT
Gene Name Cxcl3 chemokine (C-X-C motif) ligand 3 [ Mus musculus (house mouse) ]
Official Symbol Cxcl3
Synonyms Cxcl3; chemokine (C-X-C motif) ligand 3; Dci; Dcip1; Gm1960; C-X-C motif chemokine 3; dendritic cell inflammatory protein 1
Gene ID 330122
mRNA Refseq NM_203320
Protein Refseq NP_976065
UniProt ID Q6W5C0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl3 Products

Required fields are marked with *

My Review for All Cxcl3 Products

Required fields are marked with *

0
cart-icon