Recombinant Mouse Cxcl3 Protein, His-tagged
| Cat.No. : | Cxcl3-7390M |
| Product Overview : | Recombinant mouse CXCL3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-100 |
| Description : | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. |
| Form : | Liquid |
| Molecular Mass : | 10.6 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Purity : | > 90 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 0.25 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 50 % glycerol 0.15 M NaCl,5 mM DTT |
| Gene Name | Cxcl3 chemokine (C-X-C motif) ligand 3 [ Mus musculus (house mouse) ] |
| Official Symbol | Cxcl3 |
| Synonyms | Cxcl3; chemokine (C-X-C motif) ligand 3; Dci; Dcip1; Gm1960; C-X-C motif chemokine 3; dendritic cell inflammatory protein 1 |
| Gene ID | 330122 |
| mRNA Refseq | NM_203320 |
| Protein Refseq | NP_976065 |
| UniProt ID | Q6W5C0 |
| ◆ Recombinant Proteins | ||
| Cxcl3-610M | Recombinant Mouse Cxcl3 protein | +Inquiry |
| CXCL3-001H | Recombinant Human CXCL3 Protein, MBP-tagged | +Inquiry |
| CXCL3-29040TH | Recombinant Human CXCL3, MBP-tagged | +Inquiry |
| Cxcl3-297C | Active Recombinant Rat Cxcl3 Protein (68 aa) | +Inquiry |
| Cxcl3-349M | Recombinant Mouse Cxcl3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl3 Products
Required fields are marked with *
My Review for All Cxcl3 Products
Required fields are marked with *
