Recombinant Full Length Human CXCL3 Protein, GST-tagged

Cat.No. : CXCL3-2288HF
Product Overview : Human CXCL3 full-length ORF ( NP_002081.2, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 107 amino acids
Description : This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014]
Molecular Mass : 37.7 kDa
AA Sequence : MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL3 chemokine (C-X-C motif) ligand 3 [ Homo sapiens ]
Official Symbol CXCL3
Synonyms CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b
Gene ID 2921
mRNA Refseq NM_002090
Protein Refseq NP_002081
MIM 139111
UniProt ID P19876

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL3 Products

Required fields are marked with *

My Review for All CXCL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon