Recombinant Full Length Human CXCL3 Protein, GST-tagged
| Cat.No. : | CXCL3-2288HF |
| Product Overview : | Human CXCL3 full-length ORF ( NP_002081.2, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 107 amino acids |
| Description : | This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 37.7 kDa |
| AA Sequence : | MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CXCL3 chemokine (C-X-C motif) ligand 3 [ Homo sapiens ] |
| Official Symbol | CXCL3 |
| Synonyms | CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b |
| Gene ID | 2921 |
| mRNA Refseq | NM_002090 |
| Protein Refseq | NP_002081 |
| MIM | 139111 |
| UniProt ID | P19876 |
| ◆ Recombinant Proteins | ||
| Cxcl3-151M | Active Recombinant Mouse Cxcl3 Protein (Ala28-Gln87), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| CXCL3-4106M | Recombinant Mouse CXCL3 Protein | +Inquiry |
| CXCL3-29040TH | Recombinant Human CXCL3, MBP-tagged | +Inquiry |
| CXCL3-270C | Active Recombinant Human CXCL3 Protein (73 aa) | +Inquiry |
| CXCL3-2288HF | Recombinant Full Length Human CXCL3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL3 Products
Required fields are marked with *
My Review for All CXCL3 Products
Required fields are marked with *
