Recombinant Full Length Human CXCL3 Protein, GST-tagged
Cat.No. : | CXCL3-2288HF |
Product Overview : | Human CXCL3 full-length ORF ( NP_002081.2, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 107 amino acids |
Description : | This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXCL3 chemokine (C-X-C motif) ligand 3 [ Homo sapiens ] |
Official Symbol | CXCL3 |
Synonyms | CXCL3; chemokine (C-X-C motif) ligand 3; GRO3, GRO3 oncogene; C-X-C motif chemokine 3; CINC 2b; GROg; MIP 2b; SCYB3; GRO-gamma; MIP2-beta; MGSA gamma; GRO3 oncogene; GRO-gamma(1-73); growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma; GRO3; MIP2B; MIP-2b; CINC-2b |
Gene ID | 2921 |
mRNA Refseq | NM_002090 |
Protein Refseq | NP_002081 |
MIM | 139111 |
UniProt ID | P19876 |
◆ Recombinant Proteins | ||
Cxcl3-373M | Recombinant Mouse Chemokine (C-X-C motif) Ligand 3 | +Inquiry |
Cxcl3-610M | Recombinant Mouse Cxcl3 protein | +Inquiry |
CXCL3-131H | Recombinant Human CXCL3 Protein, His-tagged | +Inquiry |
CXCL3-2288HF | Recombinant Full Length Human CXCL3 Protein, GST-tagged | +Inquiry |
CXCL3-84H | Recombinant Human Chemokine (C-X-C motif) Ligand 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL3-207HCL | Recombinant Human CXCL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL3 Products
Required fields are marked with *
My Review for All CXCL3 Products
Required fields are marked with *