| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-187aa |
| Description : |
Enables dihydrofolate reductase activity and folate reductase activity. Involved in several processes, including positive regulation of nitric-oxide synthase activity; tetrahydrobiopterin biosynthetic process; and tetrahydrofolate metabolic process. Acts upstream of or within dTMP biosynthetic process. Located in mitochondrion. Is active in cytosol and nucleus. Is expressed in several structures, including genitourinary system; hemolymphoid system; integumental system; limb; and nervous system. Human ortholog(s) of this gene implicated in acute lymphoblastic leukemia. Orthologous to several human genes including DHFR (dihydrofolate reductase). |
| Form : |
Liquid in 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl. |
| Bio-activity : |
Specific activity is > 2000 pmol/min/μg, and is defined as the amount of enzyme that converts 1.0 pmole of dihydrofolic acid to tetrahydrofolic acid per minute at pH 6.5 at 25 centigrade. |
| Molecular Mass : |
23.8 kDa (207aa) confirmed by MALDI-TOF |
| AASequence : |
< MGSSHHHHHHSSGLVPRGSH>MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEKKD |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
| Reference : |
1. Chen MJ., et al. (1984) J Biol Chem. 259(6):3933-43.
2. Cody V., et al. (2009) Biochemistry. 48(8):1702-11. |
