Recombinant Mouse DOCK8 Protein (561-730 aa), His-tagged

Cat.No. : DOCK8-2251M
Product Overview : Recombinant Mouse DOCK8 Protein (561-730 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 561-730 aa
Description : Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.2 kDa
AA Sequence : RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Dock8 dedicator of cytokinesis 8 [ Mus musculus (house mouse) ]
Official Symbol DOCK8
Synonyms Dock8; AI461977; 1200017A24Rik; 5830472H07Rik; A130095G14Rik;
Gene ID 76088
mRNA Refseq NM_028785
Protein Refseq NP_083061
UniProt ID Q8C147

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOCK8 Products

Required fields are marked with *

My Review for All DOCK8 Products

Required fields are marked with *

0
cart-icon
0
compare icon