Recombinant Mouse Dock8 protein, His-tagged
Cat.No. : | Dock8-4614M |
Product Overview : | Recombinant Mouse Dock8 protein(Q8C147)(1633-2067aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1633-2067aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.8 kDa |
AA Sequence : | KSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
DOCK8-2418M | Recombinant Mouse DOCK8 Protein (561-730 aa), His-tagged | +Inquiry |
DOCK8-4758M | Recombinant Mouse DOCK8 Protein | +Inquiry |
Dock8-2628M | Recombinant Mouse Dock8 Protein, Myc/DDK-tagged | +Inquiry |
DOCK8-2255H | Recombinant Human DOCK8 Protein (560-729 aa), His-tagged | +Inquiry |
DOCK8-3734H | Recombinant Human DOCK8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dock8 Products
Required fields are marked with *
My Review for All Dock8 Products
Required fields are marked with *