Recombinant Mouse Echs1 protein, His&Myc-tagged
| Cat.No. : | Echs1-4607M |
| Product Overview : | Recombinant Mouse Echs1 protein(Q8BH95)(28-290aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 28-290aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.5 kDa |
| AA Sequence : | ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Echs1 enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [ Mus musculus ] |
| Official Symbol | Echs1 |
| Synonyms | ECHS1; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH; enoyl-CoA hydratase 1; short chain enoyl-CoA hydratase; short-chain enoyl-CoA hydratase; C80529; |
| Gene ID | 93747 |
| mRNA Refseq | NM_053119 |
| Protein Refseq | NP_444349 |
| ◆ Recombinant Proteins | ||
| ECHS1-798H | Recombinant Human ECHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECHS1-1661R | Recombinant Rat ECHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECHS1-1352HFL | Recombinant Full Length Human ECHS1 Protein, C-Flag-tagged | +Inquiry |
| ECHS1-28225TH | Recombinant Human ECHS1, His-tagged | +Inquiry |
| Echs1-4227H | Recombinant Human Echs1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Echs1 Products
Required fields are marked with *
My Review for All Echs1 Products
Required fields are marked with *
