Recombinant Mouse Echs1 protein, His&Myc-tagged
Cat.No. : | Echs1-4607M |
Product Overview : | Recombinant Mouse Echs1 protein(Q8BH95)(28-290aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 28-290aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Echs1 enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [ Mus musculus ] |
Official Symbol | Echs1 |
Synonyms | ECHS1; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH; enoyl-CoA hydratase 1; short chain enoyl-CoA hydratase; short-chain enoyl-CoA hydratase; C80529; |
Gene ID | 93747 |
mRNA Refseq | NM_053119 |
Protein Refseq | NP_444349 |
◆ Recombinant Proteins | ||
ECHS1-4969M | Recombinant Mouse ECHS1 Protein | +Inquiry |
Echs1-4225M | Recombinant Mouse Echs1 protein, His & HA-tagged | +Inquiry |
ECHS1-4803C | Recombinant Chicken ECHS1 | +Inquiry |
ECHS1-798H | Recombinant Human ECHS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Echs1-4227H | Recombinant Human Echs1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Echs1 Products
Required fields are marked with *
My Review for All Echs1 Products
Required fields are marked with *
0
Inquiry Basket