Recombinant Mouse Echs1 protein, His&Myc-tagged

Cat.No. : Echs1-4607M
Product Overview : Recombinant Mouse Echs1 protein(Q8BH95)(28-290aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 28-290aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.5 kDa
AA Sequence : ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Echs1 enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [ Mus musculus ]
Official Symbol Echs1
Synonyms ECHS1; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH; enoyl-CoA hydratase 1; short chain enoyl-CoA hydratase; short-chain enoyl-CoA hydratase; C80529;
Gene ID 93747
mRNA Refseq NM_053119
Protein Refseq NP_444349

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Echs1 Products

Required fields are marked with *

My Review for All Echs1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon