Recombinant Human ECHS1, His-tagged
Cat.No. : | ECHS1-28225TH |
Product Overview : | Recombinant full length Human Mitochondrial ECHS1 with an N terminal His tag , |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 263 amino acids |
Description : | The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. |
Conjugation : | HIS |
Molecular Weight : | 30.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ |
Gene Name | ECHS1 enoyl CoA hydratase, short chain, 1, mitochondrial [ Homo sapiens ] |
Official Symbol | ECHS1 |
Synonyms | ECHS1; enoyl CoA hydratase, short chain, 1, mitochondrial; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH; |
Gene ID | 1892 |
mRNA Refseq | NM_004092 |
Protein Refseq | NP_004083 |
MIM | 602292 |
Uniprot ID | P30084 |
Chromosome Location | 10q26.2-q26.3 |
Pathway | Beta oxidation of butanoyl-CoA to acetyl-CoA, organism-specific biosystem; Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of hexanoyl-CoA to butanoyl-CoA, organism-specific biosystem; Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of octanoyl-CoA to hexanoyl-CoA, organism-specific biosystem; |
Function | enoyl-CoA hydratase activity; lyase activity; protein binding; |
◆ Recombinant Proteins | ||
Echs1-2328M | Recombinant Mouse Echs1 protein, His&Myc-tagged | +Inquiry |
ECHS1-4803C | Recombinant Chicken ECHS1 | +Inquiry |
ECHS1-2811H | Recombinant Human ECHS1, His-tagged | +Inquiry |
ECHS1-3034H | Recombinant Human ECHS1 Protein, GST-tagged | +Inquiry |
ECHS1-1352HFL | Recombinant Full Length Human ECHS1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECHS1 Products
Required fields are marked with *
My Review for All ECHS1 Products
Required fields are marked with *
0
Inquiry Basket