Recombinant Human ECHS1, His-tagged

Cat.No. : ECHS1-28225TH
Product Overview : Recombinant full length Human Mitochondrial ECHS1 with an N terminal His tag ,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 263 amino acids
Description : The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.
Conjugation : HIS
Molecular Weight : 30.600kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Gene Name ECHS1 enoyl CoA hydratase, short chain, 1, mitochondrial [ Homo sapiens ]
Official Symbol ECHS1
Synonyms ECHS1; enoyl CoA hydratase, short chain, 1, mitochondrial; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH;
Gene ID 1892
mRNA Refseq NM_004092
Protein Refseq NP_004083
MIM 602292
Uniprot ID P30084
Chromosome Location 10q26.2-q26.3
Pathway Beta oxidation of butanoyl-CoA to acetyl-CoA, organism-specific biosystem; Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of hexanoyl-CoA to butanoyl-CoA, organism-specific biosystem; Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of octanoyl-CoA to hexanoyl-CoA, organism-specific biosystem;
Function enoyl-CoA hydratase activity; lyase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECHS1 Products

Required fields are marked with *

My Review for All ECHS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon