Recombinant Mouse Eng Protein
| Cat.No. : | Eng-7199M |
| Product Overview : | Recombinant Mouse Soluble CD105/Endoglin without tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Description : | Broad expression in lung adult (RPKM 303.5), adrenal adult (RPKM 138.1) and 16 other tissues. |
| Form : | Lyophilized |
| Molecular Mass : | 70-75 kDa |
| AA Sequence : | ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH |
| Endotoxin : | < 0.1 ng/μg of sCD105 |
| Purity : | > 90 % by SDS-PAGE and visualized by Silver stain |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing. |
| Storage Buffer : | PBS |
| Reconstitution : | The lyophilized sCD105 is soluble in water and most aqueous buffers. Restore in PBS or medium to a concentration not lower than 50 μg/mL. |
| Gene Name | Eng endoglin [ Mus musculus (house mouse) ] |
| Official Symbol | Eng |
| Synonyms | Eng; endoglin; En; Endo; CD105; AI528660; AI662476; S-endoglin; endoglin; cell surface MJ7/18 antigen; transmembrane glycoprotein |
| Gene ID | 13805 |
| mRNA Refseq | NM_001146348 |
| Protein Refseq | NP_001139820 |
| UniProt ID | Q3UAM9 |
| ◆ Recombinant Proteins | ||
| ENG-132H | Recombinant Human Endoglin | +Inquiry |
| Eng-638R | Active Recombinant Rat Eng, Fc Chimera | +Inquiry |
| Eng-10540M | Recombinant Mouse Eng Protein, His (Fc)-Avi-tagged | +Inquiry |
| Eng-449M | Active Recombinant Mouse Endoglin | +Inquiry |
| ENG-12449H | Recombinant Human ENG, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENG-2267MCL | Recombinant Mouse ENG cell lysate | +Inquiry |
| ENG-2457HCL | Recombinant Human ENG cell lysate | +Inquiry |
| ENG-157HKCL | Human ENG Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Eng Products
Required fields are marked with *
My Review for All Eng Products
Required fields are marked with *



