Recombinant Mouse Eng Protein

Cat.No. : Eng-7199M
Product Overview : Recombinant Mouse Soluble CD105/Endoglin without tag was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Description : Broad expression in lung adult (RPKM 303.5), adrenal adult (RPKM 138.1) and 16 other tissues.
Form : Lyophilized
Molecular Mass : 70-75 kDa
AA Sequence : ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
Endotoxin : < 0.1 ng/μg of sCD105
Purity : > 90 % by SDS-PAGE and visualized by Silver stain
Stability : Shelf life: one year from despatch.
Storage : Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
Avoid repeated freezing and thawing.
Storage Buffer : PBS
Reconstitution : The lyophilized sCD105 is soluble in water and most aqueous buffers. Restore in PBS or medium to a concentration not lower than 50 μg/mL.
Gene Name Eng endoglin [ Mus musculus (house mouse) ]
Official Symbol Eng
Synonyms Eng; endoglin; En; Endo; CD105; AI528660; AI662476; S-endoglin; endoglin; cell surface MJ7/18 antigen; transmembrane glycoprotein
Gene ID 13805
mRNA Refseq NM_001146348
Protein Refseq NP_001139820
UniProt ID Q3UAM9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Eng Products

Required fields are marked with *

My Review for All Eng Products

Required fields are marked with *

0
cart-icon
0
compare icon