Recombinant Mouse Eng Protein
Cat.No. : | Eng-7199M |
Product Overview : | Recombinant Mouse Soluble CD105/Endoglin without tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Description : | Broad expression in lung adult (RPKM 303.5), adrenal adult (RPKM 138.1) and 16 other tissues. |
Form : | Lyophilized |
Molecular Mass : | 70-75 kDa |
AA Sequence : | ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH |
Endotoxin : | < 0.1 ng/μg of sCD105 |
Purity : | > 90 % by SDS-PAGE and visualized by Silver stain |
Stability : | Shelf life: one year from despatch. |
Storage : | Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing. |
Storage Buffer : | PBS |
Reconstitution : | The lyophilized sCD105 is soluble in water and most aqueous buffers. Restore in PBS or medium to a concentration not lower than 50 μg/mL. |
Gene Name | Eng endoglin [ Mus musculus (house mouse) ] |
Official Symbol | Eng |
Synonyms | Eng; endoglin; En; Endo; CD105; AI528660; AI662476; S-endoglin; endoglin; cell surface MJ7/18 antigen; transmembrane glycoprotein |
Gene ID | 13805 |
mRNA Refseq | NM_001146348 |
Protein Refseq | NP_001139820 |
UniProt ID | Q3UAM9 |
◆ Recombinant Proteins | ||
Eng-449M | Active Recombinant Mouse Endoglin | +Inquiry |
ENG-63H | Active Recombinant Human ENG protein, hFc-tagged | +Inquiry |
ENG-1425H | Recombinant Human ENG Protein, His-tagged | +Inquiry |
ENG-3642C | Recombinant Chicken ENG | +Inquiry |
Eng-5694R | Recombinant Rat Eng protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENG-2457HCL | Recombinant Human ENG cell lysate | +Inquiry |
ENG-2267MCL | Recombinant Mouse ENG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Eng Products
Required fields are marked with *
My Review for All Eng Products
Required fields are marked with *
0
Inquiry Basket