Recombinant Mouse ERAP1 Protein (731-930 aa), His-Myc-tagged

Cat.No. : ERAP1-2101M
Product Overview : Recombinant Mouse ERAP1 Protein (731-930 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 731-930 aa
Description : Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.3 kDa
AA Sequence : PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Erap1 endoplasmic reticulum aminopeptidase 1 [ Mus musculus ]
Official Symbol ERAP1
Synonyms ERAP1; A-LAP; ARTS-1; PILS-AP; Arts1; ERAAP; PILSA; PILSAP;
Gene ID 80898
mRNA Refseq NM_030711
Protein Refseq NP_109636
UniProt ID Q9EQH2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERAP1 Products

Required fields are marked with *

My Review for All ERAP1 Products

Required fields are marked with *

0
cart-icon