Recombinant Mouse ERAP1 Protein (731-930 aa), His-Myc-tagged
Cat.No. : | ERAP1-2101M |
Product Overview : | Recombinant Mouse ERAP1 Protein (731-930 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 731-930 aa |
Description : | Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.3 kDa |
AA Sequence : | PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Erap1 endoplasmic reticulum aminopeptidase 1 [ Mus musculus ] |
Official Symbol | ERAP1 |
Synonyms | ERAP1; A-LAP; ARTS-1; PILS-AP; Arts1; ERAAP; PILSA; PILSAP; |
Gene ID | 80898 |
mRNA Refseq | NM_030711 |
Protein Refseq | NP_109636 |
UniProt ID | Q9EQH2 |
◆ Recombinant Proteins | ||
ERAP1-2101M | Recombinant Mouse ERAP1 Protein (731-930 aa), His-Myc-tagged | +Inquiry |
ERAP1-5838H | Recombinant Human ERAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARTS-1-873H | Recombinant Human ARTS-1 protein, GST-tagged | +Inquiry |
ERAP1-2119H | Recombinant Human ERAP1 Protein, MYC/DDK-tagged | +Inquiry |
ERAP1-665HFL | Recombinant Full Length Human ERAP1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERAP1 Products
Required fields are marked with *
My Review for All ERAP1 Products
Required fields are marked with *
0
Inquiry Basket