Recombinant Human ARTS-1 protein, GST-tagged

Cat.No. : ARTS-1-873H
Product Overview : Human ARTS-1 partial ORF ( AAH30775, 832 a.a. - 941 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 832-941 a.a.
Description : The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.[provided by RefSeq, Oct 2010]
Molecular Mass : 37.73 kDa
AA Sequence : FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ERAP1 endoplasmic reticulum aminopeptidase 1 [ Homo sapiens ]
Official Symbol ERAP1
Synonyms ERAP1; endoplasmic reticulum aminopeptidase 1; A LAP; adipocyte derived leucine aminopeptidase; aminopeptidase regulator of TNFR1 shedding; ARTS 1; ERAAP1; KIAA0525; PILS AP; puromycin insensitive leucyl specific aminopeptidase; aminopeptidase PILS; adipocyte-derived leucine aminopeptidase; puromycin-insensitive leucyl-specific aminopeptidase; endoplasmic reticulum aminopeptidase associated with antigen processing; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; PILSAP; PILS-AP;
Gene ID 51752
mRNA Refseq NM_001040458
Protein Refseq NP_001035548
MIM 606832
UniProt ID Q9NZ08

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERAP1 Products

Required fields are marked with *

My Review for All ERAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon