Recombinant Human ARTS-1 protein, GST-tagged
Cat.No. : | ARTS-1-873H |
Product Overview : | Human ARTS-1 partial ORF ( AAH30775, 832 a.a. - 941 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 832-941 a.a. |
Description : | The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.[provided by RefSeq, Oct 2010] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERAP1 endoplasmic reticulum aminopeptidase 1 [ Homo sapiens ] |
Official Symbol | ERAP1 |
Synonyms | ERAP1; endoplasmic reticulum aminopeptidase 1; A LAP; adipocyte derived leucine aminopeptidase; aminopeptidase regulator of TNFR1 shedding; ARTS 1; ERAAP1; KIAA0525; PILS AP; puromycin insensitive leucyl specific aminopeptidase; aminopeptidase PILS; adipocyte-derived leucine aminopeptidase; puromycin-insensitive leucyl-specific aminopeptidase; endoplasmic reticulum aminopeptidase associated with antigen processing; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; PILSAP; PILS-AP; |
Gene ID | 51752 |
mRNA Refseq | NM_001040458 |
Protein Refseq | NP_001035548 |
MIM | 606832 |
UniProt ID | Q9NZ08 |
◆ Recombinant Proteins | ||
ERAP1-5838H | Recombinant Human ERAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERAP1-665HFL | Recombinant Full Length Human ERAP1 Protein, C-Flag-tagged | +Inquiry |
ERAP1-5276M | Recombinant Mouse ERAP1 Protein | +Inquiry |
ERAP1-855H | Recombinant Human ERAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERAP1-4254H | Recombinant Human ERAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERAP1 Products
Required fields are marked with *
My Review for All ERAP1 Products
Required fields are marked with *