"ERAP1" Related Products

Expand
Expand

Recombinant Human ARTS-1 protein, GST-tagged

Cat.No.: ARTS-1-873H
Product Overview: Human ARTS-1 partial ORF ( AAH30775, 832 a.a. - 941 a.a.) recombinant protein with GST-tag at N-terminal.
Description: The protein encoded by this gene is an aminopeptidase involved in trimming HLA class I-binding precursors so that they can be presented on MHC class I molecules. The encoded protein acts as a monomer or as a heterodimer with ERAP2. This protein may also be involved in blood pressure regulation by inactivation of angiotensin II. Three transcript variants encoding two different isoforms have been found for this gene.[provided by RefSeq, Oct 2010]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 37.73 kDa
AA Sequence: FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ERAP1 endoplasmic reticulum aminopeptidase 1 [ Homo sapiens ]
Official Symbol: ERAP1
Synonyms: ERAP1; endoplasmic reticulum aminopeptidase 1; A LAP; adipocyte derived leucine aminopeptidase; aminopeptidase regulator of TNFR1 shedding; ARTS 1; ERAAP1; KIAA0525; PILS AP; puromycin insensitive leucyl specific aminopeptidase; aminopeptidase PILS; adipocyte-derived leucine aminopeptidase; puromycin-insensitive leucyl-specific aminopeptidase; endoplasmic reticulum aminopeptidase associated with antigen processing; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; ALAP; A-LAP; ARTS1; ERAAP; APPILS; ARTS-1; PILSAP; PILS-AP;
Gene ID: 51752
mRNA Refseq: NM_001040458
Protein Refseq: NP_001035548
MIM: 606832
UniProt ID: Q9NZ08

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.