Recombinant Mouse Esm1 protein, His-SUMO-tagged
Cat.No. : | Esm1-2871M |
Product Overview : | Recombinant Mouse Esm1 protein(Q9QYY7)(22-184aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-184aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.7 kDa |
AA Sequence : | AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Esm1 endothelial cell-specific molecule 1 [ Mus musculus ] |
Official Symbol | Esm1 |
Synonyms | ESM1; endothelial cell-specific molecule 1; ESM-1; AV004503; 0610042H23Rik; |
Gene ID | 71690 |
mRNA Refseq | NM_023612 |
Protein Refseq | NP_076101 |
◆ Recombinant Proteins | ||
Esm1-5144M | Recombinant Mouse Esm1 Protein (Tyr24-Arg184), N-His tagged | +Inquiry |
ESM1-2758H | Recombinant Human ESM1 Protein (Tyr24-Arg184), His tagged | +Inquiry |
ESM1-1806R | Recombinant Rat ESM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESM1-04H | Recombinant Human ESM1 Protein (20-184aa), C-His tagged | +Inquiry |
ESM1-902H | Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Esm1 Products
Required fields are marked with *
My Review for All Esm1 Products
Required fields are marked with *