Recombinant Mouse Esm1 protein, His-SUMO-tagged
| Cat.No. : | Esm1-2871M |
| Product Overview : | Recombinant Mouse Esm1 protein(Q9QYY7)(22-184aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 22-184aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.7 kDa |
| AA Sequence : | AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Esm1 endothelial cell-specific molecule 1 [ Mus musculus ] |
| Official Symbol | Esm1 |
| Synonyms | ESM1; endothelial cell-specific molecule 1; ESM-1; AV004503; 0610042H23Rik; |
| Gene ID | 71690 |
| mRNA Refseq | NM_023612 |
| Protein Refseq | NP_076101 |
| ◆ Recombinant Proteins | ||
| ESM1-4707HF | Recombinant Full Length Human ESM1 Protein, GST-tagged | +Inquiry |
| Esm1-6501M | Recombinant Mouse Esm1 Protein (Trp20-Arg184), C-His tagged | +Inquiry |
| ESM1-4577Z | Recombinant Zebrafish ESM1 | +Inquiry |
| ESM1-7082H | Recombinant Human ESM1, His-tagged | +Inquiry |
| ESM1-3500H | Recombinant Human ESM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESM1-001MCL | Recombinant Mouse ESM1 cell lysate | +Inquiry |
| ESM1-001HCL | Recombinant Human ESM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Esm1 Products
Required fields are marked with *
My Review for All Esm1 Products
Required fields are marked with *



