Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
173 |
Description : |
Fibroblast growth factor 10 belongs to the fibroblast growth factor (FGF) family, which is involved in a variety of biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Like most other FGF family members, FGF-10 also has a heparin-binding domain and plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. In addition, FGF-10 may take parts in wound healing and is required for normal branching morphogenesis. Recombinant murine FGF-10 contains a 173 amino acids and it shares 94 % and 100 % a.a. sequence identity with human and rat FGF-10. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, 600 mM NaCl, pH 7.4, 1 mM mercaptoethanol. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : |
Approximately19.5 kDa, a single non-glycosylated polypeptide chain containing 173 amino acids. |
AA Sequence : |
QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT |
Endotoxin : |
Less than 1 EU/µg of rMuKGF-2/FGF-10 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |