Recombinant Mouse Fgf8 protein

Cat.No. : Fgf8-539M
Product Overview : Recombinant Mouse Fgf8 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 246
Description : Murine FGF-8 is a heparin binding growth factor belonging to the FGF family, which plays a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. Murine FGF-8 is first purified from an androgen-dependent mouse mammary carcinoma cell line as an androgen induces secretion. Cloning and analysis of the murine FGF8 gene revealed at least eight potential protein isoforms (FGF-8a-h). Murine FGF-8a and b share 100 % amino acid identity with that in humans, and murine FGF-8e and f share 98 % amino acid identity with humans. None of the FGF-8 isoforms exhibited activity to FGFR1b, 2b, 3b, but FGFR2c, 3c and FGFR4 can be activated by several FGF-8 isoforms. FGF-8 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration, and it is required for normal brain, eye, ear and limb development during embryogenesis.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 500 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg in the presence of 10 μg/ml of heparin.
Molecular Mass : Approximately 28.1 kDa, a single non-glycosylated polypeptide chain containing 246 amino acids.
AA Sequence : QVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Endotoxin : Less than 1 EU/µg of rMuFGF-8 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Fgf8
Official Symbol Fgf8
Synonyms FGF8; fibroblast growth factor 8; HBGF-8; androgen-induced growth factor; heparin-binding growth factor 8; Aigf; Fgf-8; MGC59627;
Gene ID 14179
mRNA Refseq NM_001166361
Protein Refseq NP_001159833
UniProt ID P37237

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf8 Products

Required fields are marked with *

My Review for All Fgf8 Products

Required fields are marked with *

0
cart-icon
0
compare icon