Recombinant Mouse Fosl1 protein, His-tagged
Cat.No. : | Fosl1-7853M |
Product Overview : | Recombinant Mouse Fosl1 protein(P48755)(1-273aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-273a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MYRDYGEPGPSSGAGSPYGRPAQPPQAQAQTAQQQKFHLVPSIDSSSQELHWMVQPHFLGPTGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGDKKDPGGSGSTSGASSPPAPGRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL |
Gene Name | Fosl1 fos-like antigen 1 [ Mus musculus ] |
Official Symbol | Fosl1 |
Synonyms | FOSL1; fos-like antigen 1; fos-related antigen 1; Fra1; fra-1; AW538199; |
Gene ID | 14283 |
mRNA Refseq | NM_010235 |
Protein Refseq | NP_034365 |
◆ Recombinant Proteins | ||
Fosl1-1622M | Recombinant Mouse Fosl1 protein, His & T7-tagged | +Inquiry |
FOSL1-2037R | Recombinant Rat FOSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOSL1-3366H | Recombinant Human FOSL1 Protein (Met1-Leu271), N-His tagged | +Inquiry |
Fosl1-7853M | Recombinant Mouse Fosl1 protein, His-tagged | +Inquiry |
FOSL1-001H | Recombinant Human FOSL1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fosl1 Products
Required fields are marked with *
My Review for All Fosl1 Products
Required fields are marked with *