Recombinant Human FOSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FOSL1-5606H |
| Product Overview : | FOSL1 MS Standard C13 and N15-labeled recombinant protein (NP_005429) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 29.4 kDa |
| AA Sequence : | MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FOSL1 FOS-like antigen 1 [ Homo sapiens (human) ] |
| Official Symbol | FOSL1 |
| Synonyms | FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1; |
| Gene ID | 8061 |
| mRNA Refseq | NM_005438 |
| Protein Refseq | NP_005429 |
| MIM | 136515 |
| UniProt ID | P15407 |
| ◆ Recombinant Proteins | ||
| Fosl1-7853M | Recombinant Mouse Fosl1 protein, His-tagged | +Inquiry |
| FOSL1-001H | Recombinant Human FOSL1 Protein, Myc/DDK-tagged | +Inquiry |
| FOSL1-2037R | Recombinant Rat FOSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fosl1-1622M | Recombinant Mouse Fosl1 protein, His & T7-tagged | +Inquiry |
| FOSL1-8500H | Active Recombinant Human FOSL1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL1 Products
Required fields are marked with *
My Review for All FOSL1 Products
Required fields are marked with *
