Recombinant Mouse FXN Protein (78-207 aa), His-tagged
Cat.No. : | FXN-1397M |
Product Overview : | Recombinant Mouse FXN Protein (78-207 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 78-207 aa |
Description : | Promotes the biosynthesis of he and assbly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.4 kDa |
AA Sequence : | LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Fxn frataxin [ Mus musculus ] |
Official Symbol | FXN |
Synonyms | FXN; frataxin; FA; X25; FARR; Frda; |
Gene ID | 14297 |
mRNA Refseq | NM_008044 |
Protein Refseq | NP_032070 |
UniProt ID | O35943 |
◆ Recombinant Proteins | ||
FXN-4372H | Recombinant Human FXN protein, His-SUMO & Myc-tagged | +Inquiry |
FXN-530C | Recombinant Cynomolgus FXN Protein, His-tagged | +Inquiry |
FXN-3398M | Recombinant Mouse FXN Protein, His (Fc)-Avi-tagged | +Inquiry |
FXN-13051H | Recombinant Human FXN, His-tagged | +Inquiry |
FXN-2321H | Recombinant Human FXN Protein (Ser57-Leu198), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXN Products
Required fields are marked with *
My Review for All FXN Products
Required fields are marked with *
0
Inquiry Basket