Recombinant Mouse Gipr protein, His-tagged
| Cat.No. : | Gipr-4603M |
| Product Overview : | Recombinant Mouse Gipr protein(Q0P543)(19-134aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-134aa |
| Tag : | C-His |
| Form : | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is 8.622-11.36 ng/ml. |
| Molecular Mass : | 14.7 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ |
| Gene Name | Gipr gastric inhibitory polypeptide receptor [ Mus musculus ] |
| Official Symbol | Gipr |
| Synonyms | GIPR; gastric inhibitory polypeptide receptor; glucose-dependent insulinotropic polypeptide receptor; GIP-R; Gm160; Gm1081; |
| Gene ID | 381853 |
| mRNA Refseq | NM_001080815 |
| Protein Refseq | NP_001074284 |
| ◆ Recombinant Proteins | ||
| RFL32302HF | Recombinant Full Length Human Gastric Inhibitory Polypeptide Receptor(Gipr) Protein, His-Tagged | +Inquiry |
| GIPR-22H | Active Recombinant Human GIPR Fc Chimera | +Inquiry |
| Gipr-4603M | Recombinant Mouse Gipr protein, His-tagged | +Inquiry |
| GIPR-2199R | Recombinant Rat GIPR Protein, His (Fc)-Avi-tagged | +Inquiry |
| GIPR-1912H | Recombinant Human GIPR Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gipr Products
Required fields are marked with *
My Review for All Gipr Products
Required fields are marked with *
