Recombinant Mouse GUSB Protein
| Cat.No. : | Ccn4-593M |
| Product Overview : | Recombinant Mouse GUSB Protein Cys216~Arg347 (Accession # O95388) with N-terminal His Tag was expressed in E.coli. |
| Availability | November 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 216-347 a.a. |
| Description : | Broad expression in limb E14.5 (RPKM 9.0), ovary adult (RPKM 6.7) and 17 other tissues. |
| Form : | Freeze-dried powder |
| Molecular Mass : | 16.3kDa |
| AA Sequence : | MGHHHHHHSGSEFCIAYTSPWSPCSTTCGLGISTRISNVNARCWPEQESRLCNLRPCDVDIQLHIKAGKKCLAVYQPEEATNFTLAGCVSTRTYRPKYCGVCTDNRCCIPYKSKTISVDFQCPEGPGFSRQVLWINACFCNLSCR |
| Endotoxin : | <1.0 EU per 1 µg (determined by the LAL method) |
| Purity : | >95% |
| Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
| Stability : | The thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48 h, and no obvious degradation and precipitation were observed. (Referring from China Biological Products Standard, which was calculated by the Arrhenius equation.) The loss of this protein is less than 5% within the expiration date under appropriate storage condition. |
| Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
| Storage Buffer : | PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. |
| Reconstitution : | Reconstitute in sterile PBS, pH7.2 - pH7.4. |
| Gene Name | Ccn4 cellular communication network factor 4 [ Mus musculus (house mouse) ] |
| Official Symbol | Ccn4 |
| Synonyms | Ccn4; cellular communication network factor 4; Elm1; Wisp1; AW146261; WNT1-inducible-signaling pathway protein 1; CCN family member 4; WNT1 inducible signaling pathway protein 1 |
| Gene ID | 22402 |
| mRNA Refseq | NM_018865 |
| Protein Refseq | NP_061353 |
| UniProt ID | O54775 |
| ◆ Recombinant Proteins | ||
| CCN4-1805HFL | Recombinant Full Length Human CCN4 Protein, C-Flag-tagged | +Inquiry |
| CCN4-3463H | Recombinant Human CCN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CCN4-197C | Active Recombinant Human CCN4 Protein | +Inquiry |
| Ccn4-2046M | Recombinant Mouse Ccn4 Protein, Myc/DDK-tagged | +Inquiry |
| CCN4-001H | Recombinant Human cellular communication network factor 4 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccn4 Products
Required fields are marked with *
My Review for All Ccn4 Products
Required fields are marked with *
