Recombinant Mouse Hbegf protein
Cat.No. : | Hbegf-564M |
Product Overview : | Recombinant Mouse Hbegf protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 86 |
Description : | Heparin-binding epidermal growth factor (HB-EGF)-like growth factor (EGF) is found in cerebral neurons. Its expression is increased after hypoxic or ischemic injury, which also stimulates neurogenesis. HB-EGF has been implicated as a participant in a variety of normal physiological processes such as blastocyst implantation and wound healing, and in pathological processes such as tumor growth, SMC hyperplasia and atherosclerosis. The protein is an 87 amino acid mitogenic and chemotactic glycoprotein containing an EGF-like domain with six conserved cysteine residues. Mouse HB-EGF shares about 73 % a.a. sequence identity with human HB-EGF. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 10 mM PB, 500 mM NaCl, pH7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 9.8 kDa, a single non-glycosylated polypeptide chain containing 86 amino acids. |
AA Sequence : | DLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTL |
Endotoxin : | Less than 1 EU/μg of rMuHB-EGF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Hbegf |
Official Symbol | Hbegf |
Synonyms | HBEGF; heparin-binding EGF-like growth factor; proheparin-binding EGF-like growth factor; diphtheria toxin receptor; heparin binding epidermal growth factor-like growth factor; Dtr; Dts; Hegfl; AW047313; MGC107656; |
Gene ID | 15200 |
mRNA Refseq | NM_010415 |
Protein Refseq | NP_034545 |
UniProt ID | Q06186 |
◆ Recombinant Proteins | ||
Hbegf-592R | Recombinant Rat Hbegf protein | +Inquiry |
HBEGF-871H | Active Recombinant Human HBEGF | +Inquiry |
HBEGF-3493HF | Recombinant Full Length Human HBEGF Protein, GST-tagged | +Inquiry |
HBEGF-385H | Active Recombinant Human HBEGF Protein (86 aa) | +Inquiry |
HBEGF-2526H | Recombinant Human HBEGF Protein (63-148 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hbegf Products
Required fields are marked with *
My Review for All Hbegf Products
Required fields are marked with *
0
Inquiry Basket