Recombinant Mouse Hnmt protein, His&Myc-tagged
Cat.No. : | Hnmt-4643M |
Product Overview : | Recombinant Mouse Hnmt protein(Q91VF2)(1-295aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-295aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MASCMRSLFSDQGRYVESFRRFLNNSTEHQCMQEFMDKKLPGIIARIGEAKAEIKILSVGGGAGEVDLQILSKVQAQYPGICINNEVVEPSAEQIVKYKELVAKTSNMENIKFSWHKETSSEYQKRMLEEEEEPPKWDFIHMIQMLYYVKDIPATLKFFHGLLAASAKILIILVSGTSGWEKLWKKYGSRLPRDDLCQYVTSSDLAQILDDLGIKYECYDLVSTMDITDCFIDGNENGDLLWDFLTETCNFSKTAPLDLKAEIMKDLQEPEFSVKKEGKVLFNNNLSFIVVEANV |
Gene Name | Hnmt histamine N-methyltransferase [ Mus musculus ] |
Official Symbol | Hnmt |
Synonyms | HNMT; histamine N-methyltransferase; HMT; AI788969; 1500031F01Rik; |
Gene ID | 140483 |
mRNA Refseq | NM_080462 |
Protein Refseq | NP_536710 |
◆ Recombinant Proteins | ||
HNMT-5216C | Recombinant Chicken HNMT | +Inquiry |
Hnmt-4643M | Recombinant Mouse Hnmt protein, His&Myc-tagged | +Inquiry |
HNMT-1704H | Recombinant Human Histamine N-Methyltransferase, His-tagged | +Inquiry |
HNMT-27547TH | Recombinant Human HNMT | +Inquiry |
HNMT-4898H | Recombinant Human HNMT Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hnmt Products
Required fields are marked with *
My Review for All Hnmt Products
Required fields are marked with *