Recombinant Mouse Ifna2 protein, His-SUMO-tagged
Cat.No. : | Ifna2-5643M |
Product Overview : | Recombinant Mouse Ifna2 protein(P01573)(24-190aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-190a.a. |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE |
Gene Name | Ifna2 interferon alpha 2 [ Mus musculus ] |
Official Symbol | Ifna2 |
Synonyms | IFNA2; interferon alpha 2; interferon alpha-2; IFN-alpha-2; interferon alpha family, gene 2; Ifa2; |
Gene ID | 15965 |
mRNA Refseq | NM_010503 |
Protein Refseq | NP_034633 |
◆ Recombinant Proteins | ||
Ifna2-15M | Active Recombinant Mouse Ifna2 | +Inquiry |
IFNA2-17H | Recombinant Human Interferon, Alpha 2, His-tagged | +Inquiry |
IFNA2-0256H | Active Recombinant Human IFNA2 protein, Fc-tagged | +Inquiry |
IFNA2-7979H | Recombinant Human IFNA2 protein | +Inquiry |
IFNA2-381I | Active Recombinant Human IFNA2B Protein (165 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifna2 Products
Required fields are marked with *
My Review for All Ifna2 Products
Required fields are marked with *