Recombinant Mouse Ifna2 protein, His-SUMO-tagged
| Cat.No. : | Ifna2-5643M |
| Product Overview : | Recombinant Mouse Ifna2 protein(P01573)(24-190aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-190a.a. |
| Tag : | His&SUMO |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE |
| Gene Name | Ifna2 interferon alpha 2 [ Mus musculus ] |
| Official Symbol | Ifna2 |
| Synonyms | IFNA2; interferon alpha 2; interferon alpha-2; IFN-alpha-2; interferon alpha family, gene 2; Ifa2; |
| Gene ID | 15965 |
| mRNA Refseq | NM_010503 |
| Protein Refseq | NP_034633 |
| ◆ Recombinant Proteins | ||
| IFNA2-4181H | Recombinant Human IFNA2 protein, GST-tagged | +Inquiry |
| Ifna2-89M | Active Recombinant Mouse Ifna2 protein(Cys24-Glu190), hFc-tagged | +Inquiry |
| INFA2-04H | Recombinant Human HSA-Interferon Alpha-2b | +Inquiry |
| IFNA2-29498TH | Recombinant Human IFNA2 | +Inquiry |
| IFNA2-03H | Recombinant Human IFNA2 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
| IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifna2 Products
Required fields are marked with *
My Review for All Ifna2 Products
Required fields are marked with *
