Recombinant Mouse Igf1 protein

Cat.No. : Igf1-570M
Product Overview : Recombinant Mouse Igf1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 70
Description : The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 7.7 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
AA Sequence : GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Endotoxin : Less than 0.1 EU/μg of rMuIGF-1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 100mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Igf1
Official Symbol Igf1
Synonyms IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik;
Gene ID 16000
mRNA Refseq NM_001111274
Protein Refseq NP_001104744
UniProt ID P05017

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Igf1 Products

Required fields are marked with *

My Review for All Igf1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon