Recombinant Mouse Il10 protein
Cat.No. : | Il10-17M |
Product Overview : | Recombinant Mouse Il10 protein was expressed in Escherichia coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 160 |
Description : | Interleukin-10 (IL-10) is encoded by the IL10 gene and expressed in monocytes and Type 2 T helper cells (Th2). The biological activities of IL-10 are mediated by the IL-10 receptor complex, which is composed of the ligand-binding IL-10 Rα/R1 and the accessory IL-10 Rβ/R2 subunits. IL-10 is capable of inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by T helper cells. IL-10 is classified as a class 2 cytokine which consist of IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26, several interferons and interferon-like molecules. Mature murine IL-10 shares 70 %-77 % amino acid sequence identity with human, bovine, porcine IL-10, but murine IL-10 does not act on human cells. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine MC/9-2 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
AA Sequence : | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Endotoxin : | Less than 1 EU/µg of rMuIL-10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il10 |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10; |
Gene ID | 16153 |
mRNA Refseq | NM_010548 |
Protein Refseq | NP_034678 |
UniProt ID | P18893 |
◆ Recombinant Proteins | ||
IL10-262I | Active Recombinant Human IL10 Protein | +Inquiry |
IL10-103E | Recombinant Equine IL-10 | +Inquiry |
IL10-3023R | Recombinant Rat IL10 Protein | +Inquiry |
Il10-084M | Recombinant Mouse Il10 Protein, MYC/DDK-tagged | +Inquiry |
IL10-996P | Recombinant Pig IL10 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket