Recombinant Mouse Il10 protein, His-tagged
| Cat.No. : | Il10-3975M |
| Product Overview : | Recombinant Mouse Il10 protein(19-119 aa), fused to His tag, was expressed in E. coli. |
| Availability | October 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-119 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | Il10 interleukin 10 [ Mus musculus ] |
| Official Symbol | Il10 |
| Synonyms | IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10; |
| Gene ID | 16153 |
| mRNA Refseq | NM_010548 |
| Protein Refseq | NP_034678 |
| ◆ Recombinant Proteins | ||
| IL10-2288C | Active Recombinant Chicken IL10 protein, His-tagged | +Inquiry |
| Il10-128R | Recombinant Rat interleukin 10 Protein, His&Flag tagged | +Inquiry |
| IL10-79P | Recombinant Porcine Interleukin 10 | +Inquiry |
| IL10-001R | Active Recombinant Rat IL10, HIgG1 Fc-tagged | +Inquiry |
| IL10-134H | Recombinant Active Human IL10 Protein, His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
